SCOPe 2.07: Domain d4nrna_: 4nrn A:

Lineage for d4nrna_ (4nrn A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.298: RelE-like [143010] (1 superfamily)
   beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432

4. Superfamily d.298.1: RelE-like [143011] (3 families)
   Toxin component of plasmid stabilisation system

5. Family d.298.1.0: automated matches [191658] (1 protein)
   not a true family

6. Protein automated matches [191236] (7 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [255534] (2 PDB entries)

8. Domain d4nrna_: 4nrn A: [260333]
   automated match to d4ltta_
   complexed with zn

Details for d4nrna_

PDB Entry: 4nrn, 1.8 Å

PDB Description: Crystal structure of metal-bound toxin from Helicobacter pylori

PDB Compounds: (A:) metal-bound toxin

SCOPe Domain Sequences for d4nrna_:

Sequence; same for both SEQRES and ATOM records:

>d4nrna_ d.298.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mltietskkfdkdlkilvkngfdlkllykvvgnlateqplapkykdhplkgglkdfrech
lkpdlllvyqikkqentlflvrlgshself

Timeline for d4nrna_:

• d4nrna_ first appeared in SCOPe 2.04
  
• d4nrna_ appears in SCOPe 2.06
  
• d4nrna_ appears in the current release, SCOPe 2.08