Lineage for d4ltta_ (4ltt A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1947487Fold d.298: RelE-like [143010] (1 superfamily)
    beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432
  4. 1947488Superfamily d.298.1: RelE-like [143011] (3 families) (S)
    Toxin component of plasmid stabilisation system
  5. 1947504Family d.298.1.2: RelE-like [143015] (3 proteins)
    Pfam PF05016
  6. 1947511Protein automated matches [190809] (2 species)
    not a true protein
  7. 1947512Species Helicobacter pylori [TaxId:85962] [236600] (3 PDB entries)
  8. 1947513Domain d4ltta_: 4ltt A: [236606]
    automated match to d1z8ma1

Details for d4ltta_

PDB Entry: 4ltt (more details), 1.28 Å

PDB Description: Crystal structure of native apo toxin from Helicobacter pylori
PDB Compounds: (A:) Uncharacterized protein, Toxin

SCOPe Domain Sequences for d4ltta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ltta_ d.298.1.2 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mlklnlkksfqkdfdklllngfddsvlneviltlrkkepldpqfqdhalkgkwkpfrech
ikpdvllvylvkddelillrlgshselfleg

SCOPe Domain Coordinates for d4ltta_:

Click to download the PDB-style file with coordinates for d4ltta_.
(The format of our PDB-style files is described here.)

Timeline for d4ltta_: