SCOPe 2.06: Domain d4ltta1: 4ltt A:1-88

Lineage for d4ltta1 (4ltt A:1-88)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.298: RelE-like [143010] (1 superfamily)
   beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432

4. Superfamily d.298.1: RelE-like [143011] (3 families)
   Toxin component of plasmid stabilisation system

5. Family d.298.1.2: RelE-like [143015] (3 proteins)
   Pfam PF05016

6. Protein automated matches [190809] (2 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [236600] (3 PDB entries)

8. Domain d4ltta1: 4ltt A:1-88 [236606]
   Other proteins in same PDB: d4ltta2
   automated match to d1z8ma1

Details for d4ltta1

PDB Entry: 4ltt, 1.28 Å

PDB Description: Crystal structure of native apo toxin from Helicobacter pylori

PDB Compounds: (A:) Uncharacterized protein, Toxin

SCOPe Domain Sequences for d4ltta1:

Sequence; same for both SEQRES and ATOM records:

>d4ltta1 d.298.1.2 (A:1-88) automated matches {Helicobacter pylori [TaxId: 85962]}
mlklnlkksfqkdfdklllngfddsvlneviltlrkkepldpqfqdhalkgkwkpfrech
ikpdvllvylvkddelillrlgshself

Timeline for d4ltta1:

• d4ltta1 first appeared in SCOPe 2.03, called d4ltta_
  
• d4ltta1 was called d4ltta_ in SCOPe 2.05
  
• d4ltta1 appears in SCOPe 2.07
  
• d4ltta1 appears in the current release, SCOPe 2.08