Lineage for d4ltta1 (4ltt A:1-88)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615958Fold d.298: RelE-like [143010] (1 superfamily)
    beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432
  4. 2615959Superfamily d.298.1: RelE-like [143011] (3 families) (S)
    Toxin component of plasmid stabilisation system
  5. 2615979Family d.298.1.2: RelE-like [143015] (3 proteins)
    Pfam PF05016
  6. 2615986Protein automated matches [190809] (2 species)
    not a true protein
  7. 2615987Species Helicobacter pylori [TaxId:85962] [236600] (3 PDB entries)
  8. 2615988Domain d4ltta1: 4ltt A:1-88 [236606]
    Other proteins in same PDB: d4ltta2
    automated match to d1z8ma1

Details for d4ltta1

PDB Entry: 4ltt (more details), 1.28 Å

PDB Description: Crystal structure of native apo toxin from Helicobacter pylori
PDB Compounds: (A:) Uncharacterized protein, Toxin

SCOPe Domain Sequences for d4ltta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ltta1 d.298.1.2 (A:1-88) automated matches {Helicobacter pylori [TaxId: 85962]}
mlklnlkksfqkdfdklllngfddsvlneviltlrkkepldpqfqdhalkgkwkpfrech
ikpdvllvylvkddelillrlgshself

SCOPe Domain Coordinates for d4ltta1:

Click to download the PDB-style file with coordinates for d4ltta1.
(The format of our PDB-style files is described here.)

Timeline for d4ltta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ltta2