Lineage for d4ltua_ (4ltu A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540890Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2541309Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2541310Protein automated matches [191164] (24 species)
    not a true protein
  7. 2541420Species Rhodopseudomonas palustris [TaxId:316058] [260314] (1 PDB entry)
  8. 2541421Domain d4ltua_: 4ltu A: [260315]
    automated match to d3huia_
    complexed with fes

Details for d4ltua_

PDB Entry: 4ltu (more details), 2.31 Å

PDB Description: Crystal Structure of Ferredoxin from Rhodopseudomonas palustris HaA2
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d4ltua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ltua_ d.15.4.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]}
psitfihpdgrseivdaaigdsamfaalnhgidsivaecggnavcatchvyvddlwlakl
ppvdaneddlldgtasdrlpnsrlscqikiapeldglvlriperqt

SCOPe Domain Coordinates for d4ltua_:

Click to download the PDB-style file with coordinates for d4ltua_.
(The format of our PDB-style files is described here.)

Timeline for d4ltua_: