SCOPe 2.08: Domain d4ltua_: 4ltu A:

Lineage for d4ltua_ (4ltu A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (24 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:316058] [260314] (1 PDB entry)

8. Domain d4ltua_: 4ltu A: [260315]
   automated match to d3huia_
   complexed with fes

Details for d4ltua_

PDB Entry: 4ltu, 2.31 Å

PDB Description: Crystal Structure of Ferredoxin from Rhodopseudomonas palustris HaA2

PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d4ltua_:

Sequence; same for both SEQRES and ATOM records:

>d4ltua_ d.15.4.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]}
psitfihpdgrseivdaaigdsamfaalnhgidsivaecggnavcatchvyvddlwlakl
ppvdaneddlldgtasdrlpnsrlscqikiapeldglvlriperqt

Timeline for d4ltua_:

• d4ltua_ first appeared in SCOPe 2.04
  
• d4ltua_ appears in SCOPe 2.07