Lineage for d2cgab_ (2cga B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2404433Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 2404434Species Cow (Bos taurus) [TaxId:9913] [50523] (66 PDB entries)
    Uniprot P00766
  8. 2404455Domain d2cgab_: 2cga B: [26029]

Details for d2cgab_

PDB Entry: 2cga (more details), 1.8 Å

PDB Description: bovine chymotrypsinogen a. x-ray crystal structure analysis and refinement of a new crystal form at 1.8 angstroms resolution
PDB Compounds: (B:) chymotrypsinogen a

SCOPe Domain Sequences for d2cgab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cgab_ b.47.1.2 (B:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

SCOPe Domain Coordinates for d2cgab_:

Click to download the PDB-style file with coordinates for d2cgab_.
(The format of our PDB-style files is described here.)

Timeline for d2cgab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cgaa_