Lineage for d2cgab_ (2cga B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) 
Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (2 species) Species Cow (Bos taurus) [TaxId:9913] [50523] (42 PDB entries) 
Domain d2cgab_: 2cga B: [26029]
Details for d2cgab_
PDB Entry: 2cga (more details), 1.8 Å
PDB Description: bovine chymotrypsinogen a. x-ray crystal structure analysis and refinement of a new crystal form at 1.8 angstroms resolution
SCOP Domain Sequences for d2cgab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cgab_ b.47.1.2 (B:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan
SCOP Domain Coordinates for d2cgab_:
Click to download the PDB-style file with coordinates for d2cgab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cgab_:
- d2cgab_ appears in SCOP 1.57
- d2cgab_ appears in the current release, SCOPe 2.08
View in 3D
