SCOP 1.61: Domain d1ab9.1: 1ab9 A:,B:,C:

Lineage for d1ab9.1 (1ab9 A:,B:,C:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (45 PDB entries)

8. Domain d1ab9.1: 1ab9 A:,B:,C: [26022]

Details for d1ab9.1

PDB Entry: 1ab9, 1.6 Å

PDB Description: crystal structure of bovine gamma-chymotrypsin

SCOP Domain Sequences for d1ab9.1:

Sequence; same for both SEQRES and ATOM records:

>g1ab9.1 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
sasddfaagttcvttgwgltryXntpdrlqqaslpllsntnckkywgtkikdamicagas
gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

Timeline for d1ab9.1:

• d1ab9.1 first appeared (with stable ids) in SCOP 1.55
  
• d1ab9.1 appears in SCOP 1.59
  
• d1ab9.1 appears in SCOP 1.63
  
• d1ab9.1 appears in the current release, SCOPe 2.08