Lineage for d1ab9.1 (1ab9 A:,B:,C:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) 
Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (2 species) Species Cow (Bos taurus) [TaxId:9913] [50523] (42 PDB entries) 
Domain d1ab9.1: 1ab9 A:,B:,C: [26022]
Details for d1ab9.1
PDB Entry: 1ab9 (more details), 1.6 Å
PDB Description: crystal structure of bovine gamma-chymotrypsin
SCOP Domain Sequences for d1ab9.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1ab9.1 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
sasddfaagttcvttgwgltryXntpdrlqqaslpllsntnckkywgtkikdamicagas
gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
SCOP Domain Coordinates for d1ab9.1:
Click to download the PDB-style file with coordinates for d1ab9.1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ab9.1:
- d1ab9.1 appears in SCOP 1.57
- d1ab9.1 appears in the current release, SCOPe 2.08
View in 3D