Lineage for d3wsva1 (3wsv A:1-147)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831113Species Enterococcus mundtii [TaxId:53346] [259610] (2 PDB entries)
  8. 1831118Domain d3wsva1: 3wsv A:1-147 [260129]
    Other proteins in same PDB: d3wsva2, d3wsvb2, d3wsvc2, d3wsvd2
    automated match to d4ln1a1
    complexed with gol

Details for d3wsva1

PDB Entry: 3wsv (more details), 2.38 Å

PDB Description: crystal structure of minor l-lactate dehydrogenase from enterococcus mundtii in the ligands-unbound form
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3wsva1:

Sequence, based on SEQRES records: (download)

>d3wsva1 c.2.1.0 (A:1-147) automated matches {Enterococcus mundtii [TaxId: 53346]}
mkktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegealdlldgmawgekn
vsvwsgtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvv
asnpvdiltyltwqesglpasrvvgtg

Sequence, based on observed residues (ATOM records): (download)

>d3wsva1 c.2.1.0 (A:1-147) automated matches {Enterococcus mundtii [TaxId: 53346]}
mkktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegldgmawgeknvsvws
gtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvvasnpv
diltyltwqesglpasrvvgtg

SCOPe Domain Coordinates for d3wsva1:

Click to download the PDB-style file with coordinates for d3wsva1.
(The format of our PDB-style files is described here.)

Timeline for d3wsva1: