SCOPe 2.05: Domain d3wsvb2: 3wsv B:148-319

Lineage for d3wsvb2 (3wsv B:148-319)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (26 species)
   not a true protein

7. Species Enterococcus mundtii [TaxId:53346] [259612] (2 PDB entries)

8. Domain d3wsvb2: 3wsv B:148-319 [262450]
   Other proteins in same PDB: d3wsva1, d3wsvb1, d3wsvc1, d3wsvd1
   automated match to d3wsva2
   complexed with gol

Details for d3wsvb2

PDB Entry: 3wsv, 2.38 Å

PDB Description: crystal structure of minor l-lactate dehydrogenase from enterococcus mundtii in the ligands-unbound form

PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3wsvb2:

Sequence; same for both SEQRES and ATOM records:

>d3wsvb2 d.162.1.0 (B:148-319) automated matches {Enterococcus mundtii [TaxId: 53346]}
ttldttrfrkeialklavdprsvhgyilgehgdsevaawshttvggkpimeyvekdhrle
endltvladkvknaayeiidrkkatyygigmsttrivkailnneqavlpvsaylngeyge
ediftgvpsivdengvreiidlsitpqekamfhqsvselkavldtvrlehhh

Timeline for d3wsvb2:

• d3wsvb2 is new in SCOPe 2.05-stable
  
• d3wsvb2 appears in SCOPe 2.06
  
• d3wsvb2 appears in the current release, SCOPe 2.08