SCOPe 2.06: Domain d4w4kd_: 4w4k D:

Lineage for d4w4kd_ (4w4k D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.4: PE/PPE dimer-like [140459] (2 families)
   (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals inside the bundle

5. Family a.25.4.2: PPE [140463] (2 proteins)
   Pfam PF00823; contains extra C-terminal alpha-hairpin, unlike the PE family subunit

6. Protein PPE41 [140464] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [140465] (3 PDB entries)
   Uniprot Q79FE1 2-174

8. Domain d4w4kd_: 4w4k D: [260107]
   Other proteins in same PDB: d4w4ka_, d4w4kc_
   automated match to d2g38b1

Details for d4w4kd_

PDB Entry: 4w4k, 1.95 Å

PDB Description: crystal structure of a pe25-ppe41 heterodimer from a type vii secretion system of m. tuberculosis

PDB Compounds: (D:) PPE family protein PPE41

SCOPe Domain Sequences for d4w4kd_:

Sequence; same for both SEQRES and ATOM records:

>d4w4kd_ a.25.4.2 (D:) PPE41 {Mycobacterium tuberculosis [TaxId: 1773]}
hfeayppevnsaniyagpgpdsmlaaarawrsldvemtavqrsfnrtllslmdawagpvv
mqlmeaakpfvrwltdlcvqlseverqiheivrayewahhdmvplaqiynnraerqilid
nnalgqftaqiadldqeyddfwdedgevmrdyrlrvsdalskltpwkapppia

Timeline for d4w4kd_:

• d4w4kd_ first appeared in SCOPe 2.04
  
• d4w4kd_ appears in SCOPe 2.05
  
• d4w4kd_ appears in SCOPe 2.07
  
• d4w4kd_ appears in the current release, SCOPe 2.08