![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.4: PE/PPE dimer-like [140459] (2 families) ![]() (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals inside the bundle |
![]() | Family a.25.4.2: PPE [140463] (2 proteins) Pfam PF00823; contains extra C-terminal alpha-hairpin, unlike the PE family subunit |
![]() | Protein PPE41 [140464] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [140465] (3 PDB entries) Uniprot Q79FE1 2-174 |
![]() | Domain d4w4kd_: 4w4k D: [260107] Other proteins in same PDB: d4w4ka_, d4w4kc_ automated match to d2g38b1 |
PDB Entry: 4w4k (more details), 1.95 Å
SCOPe Domain Sequences for d4w4kd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w4kd_ a.25.4.2 (D:) PPE41 {Mycobacterium tuberculosis [TaxId: 1773]} hfeayppevnsaniyagpgpdsmlaaarawrsldvemtavqrsfnrtllslmdawagpvv mqlmeaakpfvrwltdlcvqlseverqiheivrayewahhdmvplaqiynnraerqilid nnalgqftaqiadldqeyddfwdedgevmrdyrlrvsdalskltpwkapppia
Timeline for d4w4kd_: