SCOPe 2.04: Domain d2stae_: 2sta E:

Lineage for d2stae_ (2sta E:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Atlantic salmon (Salmo salar) [TaxId:8030] [50520] (11 PDB entries)

8. Domain d2stae_: 2sta E: [26007]
   Other proteins in same PDB: d2stai_
   complexed with ca

Details for d2stae_

PDB Entry: 2sta, 1.8 Å

PDB Description: anionic salmon trypsin in complex with squash seed inhibitor (cucurbita maxima trypsin inhibitor i)

PDB Compounds: (E:) protein (trypsin)

SCOPe Domain Sequences for d2stae_:

Sequence; same for both SEQRES and ATOM records:

>d2stae_ b.47.1.2 (E:) Trypsin(ogen) {Atlantic salmon (Salmo salar) [TaxId: 8030]}
ivggyeckpysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg
wgntmsstadsnklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstmasy

Timeline for d2stae_:

• d2stae_ first appeared (with stable ids) in SCOP 1.55
  
• d2stae_ appears in SCOPe 2.03
  
• d2stae_ appears in SCOPe 2.05
  
• d2stae_ appears in the current release, SCOPe 2.08