Lineage for d2stae_ (2sta E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056829Protein Trypsin(ogen) [50515] (9 species)
  7. 2056830Species Atlantic salmon (Salmo salar) [TaxId:8030] [50520] (11 PDB entries)
  8. 2056842Domain d2stae_: 2sta E: [26007]
    Other proteins in same PDB: d2stai_
    complexed with ca

Details for d2stae_

PDB Entry: 2sta (more details), 1.8 Å

PDB Description: anionic salmon trypsin in complex with squash seed inhibitor (cucurbita maxima trypsin inhibitor i)
PDB Compounds: (E:) protein (trypsin)

SCOPe Domain Sequences for d2stae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2stae_ b.47.1.2 (E:) Trypsin(ogen) {Atlantic salmon (Salmo salar) [TaxId: 8030]}
ivggyeckpysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg
wgntmsstadsnklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstmasy

SCOPe Domain Coordinates for d2stae_:

Click to download the PDB-style file with coordinates for d2stae_.
(The format of our PDB-style files is described here.)

Timeline for d2stae_: