| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) ![]() single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
| Family a.137.10.1: Stathmin [101495] (2 proteins) |
| Protein Stathmin 4 [101496] (3 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
| Domain d4tuye_: 4tuy E: [260047] Other proteins in same PDB: d4tuya1, d4tuya2, d4tuyb1, d4tuyb2, d4tuyc1, d4tuyc2, d4tuyd1, d4tuyd2, d4tuyf1, d4tuyf2 automated match to d3ryce_ complexed with 36l, acp, ca, gdp, gtp, mes, mg |
PDB Entry: 4tuy (more details), 2.1 Å
SCOPe Domain Sequences for d4tuye_:
Sequence, based on SEQRES records: (download)
>d4tuye_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelk
>d4tuye_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
Timeline for d4tuye_: