Lineage for d4tuye_ (4tuy E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346684Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2346952Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2346953Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2346954Protein Stathmin 4 [101496] (3 species)
  7. 2346971Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (178 PDB entries)
  8. 2346984Domain d4tuye_: 4tuy E: [260047]
    Other proteins in same PDB: d4tuya1, d4tuya2, d4tuyb1, d4tuyb2, d4tuyc1, d4tuyc2, d4tuyd1, d4tuyd2, d4tuyf1, d4tuyf2
    automated match to d3ryce_
    complexed with 36l, acp, ca, gdp, gtp, mes, mg

Details for d4tuye_

PDB Entry: 4tuy (more details), 2.1 Å

PDB Description: Tubulin-Rhizoxin complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d4tuye_:

Sequence, based on SEQRES records: (download)

>d4tuye_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelk

Sequence, based on observed residues (ATOM records): (download)

>d4tuye_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk

SCOPe Domain Coordinates for d4tuye_:

Click to download the PDB-style file with coordinates for d4tuye_.
(The format of our PDB-style files is described here.)

Timeline for d4tuye_: