Lineage for d4rcob1 (4rco B:117-207)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2398788Family b.40.2.0: automated matches [227133] (1 protein)
    not a true family
  6. 2398789Protein automated matches [226834] (6 species)
    not a true protein
  7. 2398820Species Staphylococcus aureus [TaxId:93061] [226094] (8 PDB entries)
  8. 2398826Domain d4rcob1: 4rco B:117-207 [260017]
    Other proteins in same PDB: d4rcoa2, d4rcob2
    automated match to d2rdga1
    complexed with cl, fuc, gal, ndg, sia

Details for d4rcob1

PDB Entry: 4rco (more details), 1.9 Å

PDB Description: 1.9 angstrom crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus, in complex with sialyl-lewisx.
PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d4rcob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rcob1 b.40.2.0 (B:117-207) automated matches {Staphylococcus aureus [TaxId: 93061]}
npkfkdlrayytkpslefkneigiilkkwttirfmnvvpdyfiykialvgkddkkygegv
hrnvdvfvvleennynlekysvggitksnsk

SCOPe Domain Coordinates for d4rcob1:

Click to download the PDB-style file with coordinates for d4rcob1.
(The format of our PDB-style files is described here.)

Timeline for d4rcob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rcob2