Lineage for d2rdga1 (2rdg A:5-93)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2398788Family b.40.2.0: automated matches [227133] (1 protein)
    not a true family
  6. 2398789Protein automated matches [226834] (6 species)
    not a true protein
  7. 2398790Species Staphylococcus aureus [TaxId:1280] [225054] (10 PDB entries)
  8. 2398792Domain d2rdga1: 2rdg A:5-93 [231254]
    Other proteins in same PDB: d2rdga2
    automated match to d3o13a1
    complexed with cit, k

Details for d2rdga1

PDB Entry: 2rdg (more details), 1.6 Å

PDB Description: crystal structure of staphylococcal superantigen-like protein 11 in complex with sialyl lewis x
PDB Compounds: (A:) Superantigen-like protein 11

SCOPe Domain Sequences for d2rdga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdga1 b.40.2.0 (A:5-93) automated matches {Staphylococcus aureus [TaxId: 1280]}
vrsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdgnnen
ldvfvvregsgrqadnnsiggitktnrtq

SCOPe Domain Coordinates for d2rdga1:

Click to download the PDB-style file with coordinates for d2rdga1.
(The format of our PDB-style files is described here.)

Timeline for d2rdga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rdga2