SCOP 1.59: Domain d2trm__: 2trm -

Lineage for d2trm__ (2trm -)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)

6. Protein Trypsin(ogen) [50515] (7 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (25 PDB entries)

8. Domain d2trm__: 2trm - [25999]

Details for d2trm__

PDB Entry: 2trm, 2.8 Å

PDB Description: the three-dimensional structure of asn102 mutant of trypsin. role of asp102 in serine protease catalysis

SCOP Domain Sequences for d2trm__:

Sequence; same for both SEQRES and ATOM records:

>d2trm__ b.47.1.2 (-) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnnnimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d2trm__:

• d2trm__ first appeared (with stable ids) in SCOP 1.55
  
• d2trm__ appears in SCOP 1.57
  
• d2trm__ appears in SCOP 1.61
  
• d2trm__ appears in the current release, SCOPe 2.08, called d2trma_