PDB entry 2trm

View 2trm on RCSB PDB site
Description: the three-dimensional structure of asn102 mutant of trypsin. role of asp102 in serine protease catalysis
Deposited on 1988-04-25, released 1988-07-16
The last revision prior to the SCOP 1.59 freeze date was dated 1988-07-16, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.157
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d2trm__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2trm_ (-)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnnnimliklsspvklnarvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
    vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan