Class a: All alpha proteins [46456] (289 folds) |
Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) |
Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins) |
Protein automated matches [254474] (3 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [258305] (2 PDB entries) |
Domain d4q5sf1: 4q5s F:78-257 [259967] Other proteins in same PDB: d4q5sc_, d4q5sd_, d4q5se_, d4q5sf2, d4q5sf3 automated match to d1smyf3 protein/DNA complex; protein/RNA complex; complexed with atp, mg, zn |
PDB Entry: 4q5s (more details), 3 Å
SCOPe Domain Sequences for d4q5sf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q5sf1 a.177.1.1 (F:78-257) automated matches {Thermus thermophilus [TaxId: 300852]} sdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvrakilg sarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlrlvvs iakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqart
Timeline for d4q5sf1: