Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) |
Family a.4.13.0: automated matches [254211] (1 protein) not a true family |
Protein automated matches [254475] (3 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [257268] (3 PDB entries) |
Domain d4q5sf2: 4q5s F:258-318 [259968] Other proteins in same PDB: d4q5sc_, d4q5sd_, d4q5se_, d4q5sf1 automated match to d1smyf1 protein/DNA complex; protein/RNA complex; complexed with atp, mg, zn |
PDB Entry: 4q5s (more details), 3 Å
SCOPe Domain Sequences for d4q5sf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q5sf2 a.4.13.0 (F:258-318) automated matches {Thermus thermophilus [TaxId: 300852]} iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl e
Timeline for d4q5sf2: