Lineage for d4nfga1 (4nfg A:4-294)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002466Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2002485Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 2002486Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (198 PDB entries)
    Uniprot P00431
  8. 2002626Domain d4nfga1: 4nfg A:4-294 [259834]
    Other proteins in same PDB: d4nfga2, d4nfgb_
    automated match to d2xj5a_
    complexed with hec, hem, unx; mutant

Details for d4nfga1

PDB Entry: 4nfg (more details), 2.11 Å

PDB Description: K13R mutant of horse cytochrome c and yeast cytochrome c peroxidase complex
PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d4nfga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nfga1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwragrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d4nfga1:

Click to download the PDB-style file with coordinates for d4nfga1.
(The format of our PDB-style files is described here.)

Timeline for d4nfga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4nfga2
View in 3D
Domains from other chains:
(mouse over for more information)
d4nfgb_