Lineage for d4nfgb_ (4nfg B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303644Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2303645Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2303646Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2303863Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2303981Species Horse (Equus caballus) [TaxId:9796] [46644] (26 PDB entries)
    Uniprot P00004
  8. 2303994Domain d4nfgb_: 4nfg B: [259833]
    Other proteins in same PDB: d4nfga1, d4nfga2
    automated match to d3o1ya_
    complexed with hec, hem, unx; mutant

Details for d4nfgb_

PDB Entry: 4nfg (more details), 2.11 Å

PDB Description: K13R mutant of horse cytochrome c and yeast cytochrome c peroxidase complex
PDB Compounds: (B:) cytochrome c

SCOPe Domain Sequences for d4nfgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nfgb_ a.3.1.1 (B:) Mitochondrial cytochrome c {Horse (Equus caballus) [TaxId: 9796]}
gdvekgkkifvqrcaqchtvekggknktgpnlnglfgrktgqapgftytdanknkgitwk
eetlmeylenpkkyipgtkmifagikkkteredliaylkkatne

SCOPe Domain Coordinates for d4nfgb_:

Click to download the PDB-style file with coordinates for d4nfgb_.
(The format of our PDB-style files is described here.)

Timeline for d4nfgb_: