Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255522] (26 PDB entries) |
Domain d4ndna1: 4ndn A:15-115 [259828] Other proteins in same PDB: d4ndne_, d4ndnf_ automated match to d2obva1 complexed with edo, mg, ppk, sam |
PDB Entry: 4ndn (more details), 2.34 Å
SCOPe Domain Sequences for d4ndna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ndna1 d.130.1.0 (A:15-115) automated matches {Human (Homo sapiens) [TaxId: 9606]} egtflftsesvgeghpdkicdqisdavldahlqqdpdakvacetvaktgmillageitsr aavdyqkvvreavkhigyddsskgfdyktcnvlvaleqqsp
Timeline for d4ndna1: