Lineage for d4ndna2 (4ndn A:135-251)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582960Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2582961Protein automated matches [254617] (15 species)
    not a true protein
  7. 2583085Species Human (Homo sapiens) [TaxId:9606] [255522] (26 PDB entries)
  8. 2583189Domain d4ndna2: 4ndn A:135-251 [259829]
    Other proteins in same PDB: d4ndne_, d4ndnf_
    automated match to d2obva2
    complexed with edo, mg, ppk, sam

Details for d4ndna2

PDB Entry: 4ndn (more details), 2.34 Å

PDB Description: structural insights of mat enzymes: mata2b complexed with sam and ppnp
PDB Compounds: (A:) S-adenosylmethionine synthase isoform type-2

SCOPe Domain Sequences for d4ndna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ndna2 d.130.1.0 (A:135-251) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qglmfgyatdeteecmpltivlahklnaklaelrrngtlpwlrpdsktqvtvqymqdrga
vlpirvhtivisvqhdeevcldemrdalkekvikavvpakyldedtiyhlqpsgrfv

SCOPe Domain Coordinates for d4ndna2:

Click to download the PDB-style file with coordinates for d4ndna2.
(The format of our PDB-style files is described here.)

Timeline for d4ndna2: