Lineage for d1bra__ (1bra -)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167857Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 167858Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 167950Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins)
  6. 168441Protein Trypsin(ogen) [50515] (7 species)
  7. 168638Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (25 PDB entries)
  8. 168648Domain d1bra__: 1bra - [25980]

Details for d1bra__

PDB Entry: 1bra (more details), 2.2 Å

PDB Description: relocating a negative charge in the binding pocket of trypsin

SCOP Domain Sequences for d1bra__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bra__ b.47.1.2 (-) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkgscqgdsggp
vvcngelqgivswgygcalpdnpdvytkvcnyvdwiqdtiaan

SCOP Domain Coordinates for d1bra__:

Click to download the PDB-style file with coordinates for d1bra__.
(The format of our PDB-style files is described here.)

Timeline for d1bra__: