SCOP 1.59: Domain d1bra__: 1bra -

Lineage for d1bra__ (1bra -)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)

6. Protein Trypsin(ogen) [50515] (7 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (25 PDB entries)

8. Domain d1bra__: 1bra - [25980]

Details for d1bra__

PDB Entry: 1bra, 2.2 Å

PDB Description: relocating a negative charge in the binding pocket of trypsin

SCOP Domain Sequences for d1bra__:

Sequence; same for both SEQRES and ATOM records:

>d1bra__ b.47.1.2 (-) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkgscqgdsggp
vvcngelqgivswgygcalpdnpdvytkvcnyvdwiqdtiaan

Timeline for d1bra__:

• d1bra__ first appeared (with stable ids) in SCOP 1.55
  
• d1bra__ appears in SCOP 1.57
  
• d1bra__ appears in SCOP 1.61
  
• d1bra__ appears in the current release, SCOPe 2.08, called d1braa_