Lineage for d4k43b1 (4k43 B:5-146)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605038Protein Actin [53073] (7 species)
  7. 1605064Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (61 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 1605199Domain d4k43b1: 4k43 B:5-146 [259760]
    automated match to d1qz5a1
    complexed with 1po, adp, ca

Details for d4k43b1

PDB Entry: 4k43 (more details), 2.9 Å

PDB Description: crystal structure of actin in complex with synthetic aplc tail analogue gc04 [n-{(1e,4r,5r,7e,9s,10s,11s)-4,10-dimethoxy-11-[(2s,4s,5s)-2-(4-methoxyphenyl)-5-methyl-1,3-dioxan-4-yl]-5,9-dimethyl-6-oxododeca-1,7-dien-1-yl}-n-methylformamide]
PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d4k43b1:

Sequence, based on SEQRES records: (download)

>d4k43b1 c.55.1.1 (B:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d4k43b1 c.55.1.1 (B:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrpqkdsyvgdeaqskrgiltlkypiehg
iitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyv
aiqavlslyasg

SCOPe Domain Coordinates for d4k43b1:

Click to download the PDB-style file with coordinates for d4k43b1.
(The format of our PDB-style files is described here.)

Timeline for d4k43b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4k43b2