SCOPe 2.05: Domain d4k43b1: 4k43 B:5-146

Lineage for d4k43b1 (4k43 B:5-146)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (7 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (62 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d4k43b1: 4k43 B:5-146 [259760]
   automated match to d1qz5a1
   complexed with 1po, adp, ca

Details for d4k43b1

PDB Entry: 4k43, 2.9 Å

PDB Description: crystal structure of actin in complex with synthetic aplc tail analogue gc04 [n-{(1e,4r,5r,7e,9s,10s,11s)-4,10-dimethoxy-11-[(2s,4s,5s)-2-(4-methoxyphenyl)-5-methyl-1,3-dioxan-4-yl]-5,9-dimethyl-6-oxododeca-1,7-dien-1-yl}-n-methylformamide]

PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d4k43b1:

Sequence, based on SEQRES records:

>d4k43b1 c.55.1.1 (B:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d4k43b1 c.55.1.1 (B:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrpqkdsyvgdeaqskrgiltlkypiehg
iitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyv
aiqavlslyasg

Timeline for d4k43b1:

• d4k43b1 first appeared in SCOPe 2.04
  
• d4k43b1 appears in SCOPe 2.06
  
• d4k43b1 appears in the current release, SCOPe 2.08