SCOP 1.59: Domain d1dpo__: 1dpo -

Lineage for d1dpo__ (1dpo -)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)

6. Protein Trypsin(ogen) [50515] (7 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (25 PDB entries)

8. Domain d1dpo__: 1dpo - [25975]

Details for d1dpo__

PDB Entry: 1dpo, 1.59 Å

PDB Description: structure of rat trypsin

SCOP Domain Sequences for d1dpo__:

Sequence; same for both SEQRES and ATOM records:

>d1dpo__ b.47.1.2 (-) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdcggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1dpo__:

• d1dpo__ first appeared (with stable ids) in SCOP 1.55
  
• d1dpo__ appears in SCOP 1.57
  
• d1dpo__ appears in SCOP 1.61
  
• d1dpo__ appears in the current release, SCOPe 2.08, called d1dpoa_