Lineage for d1dpo__ (1dpo -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15329Protein Trypsin(ogen) [50515] (6 species)
  7. 15497Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (21 PDB entries)
  8. 15498Domain d1dpo__: 1dpo - [25975]

Details for d1dpo__

PDB Entry: 1dpo (more details), 1.59 Å

PDB Description: structure of rat trypsin

SCOP Domain Sequences for d1dpo__:

Sequence, based on SEQRES records: (download)

>d1dpo__ b.47.1.2 (-) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdcggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Sequence, based on observed residues (ATOM records): (download)

>d1dpo__ b.47.1.2 (-) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgleggdscqgdcggpvv
cngelqgivswgygcapdnpgvytkvcnyvdwiqdtiaan

SCOP Domain Coordinates for d1dpo__:

Click to download the PDB-style file with coordinates for d1dpo__.
(The format of our PDB-style files is described here.)

Timeline for d1dpo__: