SCOPe 2.07: Domain d1ept.1: 1ept A:,B:,C:

Lineage for d1ept.1 (1ept A:,B:,C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50517] (34 PDB entries)
   Uniprot P00761 9-231 ! Uniprot P00761

8. Domain d1ept.1: 1ept A:,B:,C: [25966]
   complexed with ca

Details for d1ept.1

PDB Entry: 1ept, 1.8 Å

PDB Description: refined 1.8 angstroms resolution crystal structure of porcine epsilon-trypsin

PDB Compounds: (A:) porcine e-trypsin, (B:) porcine e-trypsin, (C:) porcine e-trypsin

SCOPe Domain Sequences for d1ept.1:

Sequence; same for both SEQRES and ATOM records:

>g1ept.1 b.47.1.2 (A:,B:,C:) Trypsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]}
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcykXsriqvrlgehnidvle
gneqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclis
gwgntkXssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsg
gpvvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan

Timeline for d1ept.1:

• d1ept.1 first appeared (with stable ids) in SCOP 1.55
  
• d1ept.1 appears in SCOPe 2.06
  
• d1ept.1 appears in the current release, SCOPe 2.08