Lineage for d1ept.1 (1ept A:,B:,C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15329Protein Trypsin(ogen) [50515] (6 species)
  7. Species Pig (Sus scrofa) [TaxId:9823] [50517] (13 PDB entries)
  8. 15488Domain d1ept.1: 1ept A:,B:,C: [25966]

Details for d1ept.1

PDB Entry: 1ept (more details), 1.8 Å

PDB Description: refined 1.8 angstroms resolution crystal structure of porcine epsilon-trypsin
PDB Compounds: (A:) , (B:) , (C:)

SCOP Domain Sequences for d1ept.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1ept.1 b.47.1.2 (A:,B:,C:) Trypsin(ogen) {Pig (Sus scrofa)}
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcykXsriqvrlgehnidvle
gneqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclis
gwgntkXssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsg
gpvvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan

SCOP Domain Coordinates for d1ept.1:

Click to download the PDB-style file with coordinates for d1ept.1.
(The format of our PDB-style files is described here.)

Timeline for d1ept.1: