Lineage for d1ept.1 (1ept A:,B:,C:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) Protein Trypsin(ogen) [50515] (6 species) - Species Pig (Sus scrofa) [TaxId:9823] [50517] (13 PDB entries)
Domain d1ept.1: 1ept A:,B:,C: [25966]
Details for d1ept.1
PDB Entry: 1ept (more details), 1.8 Å
PDB Description: refined 1.8 angstroms resolution crystal structure of porcine epsilon-trypsin
SCOP Domain Sequences for d1ept.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1ept.1 b.47.1.2 (A:,B:,C:) Trypsin(ogen) {Pig (Sus scrofa)}
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcykXsriqvrlgehnidvle
gneqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclis
gwgntkXssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsg
gpvvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan
SCOP Domain Coordinates for d1ept.1:
Click to download the PDB-style file with coordinates for d1ept.1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ept.1:
- d1ept.1 appears in SCOP 1.57
- d1ept.1 appears in the current release, SCOPe 2.08
View in 3D