SCOPe 2.08: Domain d4cawa1: 4caw A:101-262

Lineage for d4cawa1 (4caw A:101-262)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Aspergillus fumigatus [TaxId:746128] [259642] (6 PDB entries)

8. Domain d4cawa1: 4caw A:101-262 [259643]
   automated match to d1iica1
   complexed with mya, p3u

Details for d4cawa1

PDB Entry: 4caw, 2.5 Å

PDB Description: crystal structure of aspergillus fumigatus n-myristoyl transferase in complex with myristoyl coa and a pyrazole sulphonamide ligand

PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d4cawa1:

Sequence; same for both SEQRES and ATOM records:

>d4cawa1 d.108.1.0 (A:101-262) automated matches {Aspergillus fumigatus [TaxId: 746128]}
ggpikiidpekvskepdallegfewatldltnetelqelwdlltyhyveddnamfrfrys
qsflhwalmspgwkkewhvgvratksrklvasicgvpteinvrnqklkvveinflcihkk
lrskrltpvlikeitrrcylngiyqaiytagvvlptpvsscr

Timeline for d4cawa1:

• d4cawa1 first appeared in SCOPe 2.04
  
• d4cawa1 appears in SCOPe 2.07