Lineage for d4cawa1 (4caw A:101-262)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2968999Species Aspergillus fumigatus [TaxId:746128] [259642] (6 PDB entries)
  8. 2969009Domain d4cawa1: 4caw A:101-262 [259643]
    automated match to d1iica1
    complexed with mya, p3u

Details for d4cawa1

PDB Entry: 4caw (more details), 2.5 Å

PDB Description: crystal structure of aspergillus fumigatus n-myristoyl transferase in complex with myristoyl coa and a pyrazole sulphonamide ligand
PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d4cawa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cawa1 d.108.1.0 (A:101-262) automated matches {Aspergillus fumigatus [TaxId: 746128]}
ggpikiidpekvskepdallegfewatldltnetelqelwdlltyhyveddnamfrfrys
qsflhwalmspgwkkewhvgvratksrklvasicgvpteinvrnqklkvveinflcihkk
lrskrltpvlikeitrrcylngiyqaiytagvvlptpvsscr

SCOPe Domain Coordinates for d4cawa1:

Click to download the PDB-style file with coordinates for d4cawa1.
(The format of our PDB-style files is described here.)

Timeline for d4cawa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cawa2