Lineage for d3wu2b_ (3wu2 B:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2256467Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 2256468Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 2256469Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 2256485Protein automated matches [191285] (3 species)
    not a true protein
  7. 2256493Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (15 PDB entries)
  8. 2256496Domain d3wu2b_: 3wu2 B: [259617]
    Other proteins in same PDB: d3wu2a_, d3wu2d_, d3wu2e_, d3wu2f_, d3wu2h_, d3wu2i_, d3wu2j_, d3wu2k_, d3wu2l_, d3wu2m_, d3wu2o_, d3wu2t_, d3wu2u_, d3wu2v_, d3wu2x_, d3wu2z_
    automated match to d4il6b_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, so4, sqd, unl

Details for d3wu2b_

PDB Entry: 3wu2 (more details), 1.9 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (B:) Photosystem II CP47 chlorophyll apoprotein

SCOPe Domain Sequences for d3wu2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wu2b_ f.55.1.1 (B:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf
vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle
lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv
apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss
iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea
wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa
ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya
rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
idpelspeqvewgfyqkvgdvttr

SCOPe Domain Coordinates for d3wu2b_:

Click to download the PDB-style file with coordinates for d3wu2b_.
(The format of our PDB-style files is described here.)

Timeline for d3wu2b_: