SCOPe 2.05: Domain d3wu2b_: 3wu2 B:

Lineage for d3wu2b_ (3wu2 B:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
   6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops

4. Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family)
   automatically mapped to Pfam PF00421

5. Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
   Pfam PF00421

6. Protein automated matches [191285] (2 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (4 PDB entries)

8. Domain d3wu2b_: 3wu2 B: [259617]
   Other proteins in same PDB: d3wu2a_, d3wu2d_, d3wu2e_, d3wu2f_, d3wu2h_, d3wu2i_, d3wu2j_, d3wu2k_, d3wu2l_, d3wu2m_, d3wu2o_, d3wu2t_, d3wu2u_, d3wu2v_, d3wu2x_, d3wu2z_
   automated match to d4il6b_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, so4, sqd, unl

Details for d3wu2b_

PDB Entry: 3wu2, 1.9 Å

PDB Description: crystal structure analysis of photosystem ii complex

PDB Compounds: (B:) Photosystem II CP47 chlorophyll apoprotein

SCOPe Domain Sequences for d3wu2b_:

Sequence; same for both SEQRES and ATOM records:

>d3wu2b_ f.55.1.1 (B:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf
vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle
lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv
apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss
iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea
wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa
ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya
rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
idpelspeqvewgfyqkvgdvttr

Timeline for d3wu2b_:

• d3wu2b_ first appeared in SCOPe 2.04
  
• d3wu2b_ appears in SCOPe 2.06
  
• d3wu2b_ appears in the current release, SCOPe 2.08