Lineage for d4w9fl_ (4w9f L:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378586Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2378587Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2378588Protein VHL [49470] (1 species)
  7. 2378589Species Human (Homo sapiens) [TaxId:9606] [49471] (39 PDB entries)
  8. 2378597Domain d4w9fl_: 4w9f L: [259606]
    Other proteins in same PDB: d4w9fa_, d4w9fb1, d4w9fb2, d4w9fd_, d4w9fe_, d4w9fg_, d4w9fh_, d4w9fj_, d4w9fk1, d4w9fk2
    automated match to d1lqbc_
    complexed with 3ju

Details for d4w9fl_

PDB Entry: 4w9f (more details), 2.1 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-(3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 5)
PDB Compounds: (L:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d4w9fl_:

Sequence, based on SEQRES records: (download)

>d4w9fl_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe

Sequence, based on observed residues (ATOM records): (download)

>d4w9fl_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyedledh
pnvqkdlerltqe

SCOPe Domain Coordinates for d4w9fl_:

Click to download the PDB-style file with coordinates for d4w9fl_.
(The format of our PDB-style files is described here.)

Timeline for d4w9fl_: