SCOPe 2.07: Domain d4w9fb1: 4w9f B:17-112

Lineage for d4w9fb1 (4w9f B:17-112)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein Elongin C [54699] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54700] (54 PDB entries)

8. Domain d4w9fb1: 4w9f B:17-112 [264045]
   Other proteins in same PDB: d4w9fa_, d4w9fb2, d4w9fc_, d4w9fd_, d4w9ff_, d4w9fg_, d4w9fi_, d4w9fj_, d4w9fk2, d4w9fl_
   automated match to d4b9kb_
   complexed with 3ju

Details for d4w9fb1

PDB Entry: 4w9f, 2.1 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-(3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 5)

PDB Compounds: (B:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d4w9fb1:

Sequence, based on SEQRES records:

>d4w9fb1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records):

>d4w9fb1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc

Timeline for d4w9fb1:

• d4w9fb1 first appeared in SCOPe 2.05, called d4w9fb_
  
• d4w9fb1 appears in SCOPe 2.06
  
• d4w9fb1 appears in the current release, SCOPe 2.08