Lineage for d4w9cc_ (4w9c C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378586Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2378587Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2378588Protein VHL [49470] (1 species)
  7. 2378589Species Human (Homo sapiens) [TaxId:9606] [49471] (39 PDB entries)
  8. 2378623Domain d4w9cc_: 4w9c C: [259571]
    Other proteins in same PDB: d4w9ca_, d4w9cb_, d4w9cd_, d4w9ce_, d4w9cg_, d4w9ch_, d4w9cj_, d4w9ck1, d4w9ck2
    automated match to d1lqbc_
    complexed with 3jg

Details for d4w9cc_

PDB Entry: 4w9c (more details), 2.2 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-(3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(oxazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 2)
PDB Compounds: (C:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d4w9cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w9cc_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerlt

SCOPe Domain Coordinates for d4w9cc_:

Click to download the PDB-style file with coordinates for d4w9cc_.
(The format of our PDB-style files is described here.)

Timeline for d4w9cc_: