Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries) |
Domain d4w9cc_: 4w9c C: [259571] Other proteins in same PDB: d4w9ca_, d4w9cb_, d4w9cd_, d4w9ce_, d4w9cg_, d4w9ch_, d4w9cj_, d4w9ck1, d4w9ck2 automated match to d1lqbc_ complexed with 3jg |
PDB Entry: 4w9c (more details), 2.2 Å
SCOPe Domain Sequences for d4w9cc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w9cc_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerlt
Timeline for d4w9cc_: