SCOPe 2.05: Domain d4u2ub_: 4u2u B:

Lineage for d4u2ub_ (4u2u B:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.0: automated matches [195065] (1 protein)
   not a true family

6. Protein automated matches [195066] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225196] (8 PDB entries)

8. Domain d4u2ub_: 4u2u B: [259549]
   automated match to d2imta_

Details for d4u2ub_

PDB Entry: 4u2u, 2.9 Å

PDB Description: bak domain swapped dimer induced by bidbh3 with chaps

PDB Compounds: (B:) bcl-2 homologous antagonist/killer

SCOPe Domain Sequences for d4u2ub_:

Sequence, based on SEQRES records:

>d4u2ub_ f.1.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mseeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvgrqlaii
gddinrrydsefqtmlqhlqptaenayeyftkiatslfesginwgrvvallgfgyrlalh
vyqhgltgflgqvtrfvvdfmlhhsiarwiaqrggwvaaln

Sequence, based on observed residues (ATOM records):

>d4u2ub_ f.1.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mseeqvaqdteevfrsyvfyrhqqeqestmgqvgrqlaiigddinrrydsefqtmlqhlq
ptaenayeyftkiatslfesginwgrvvallgfgyrlalhvyqhgltgflgqvtrfvvdf
mlhhsiarwiaqrggwvaaln

Timeline for d4u2ub_:

• d4u2ub_ first appeared in SCOPe 2.04
  
• d4u2ub_ is called d4u2ub1 in SCOPe 2.06
  
• d4u2ub_ appears in the current release, SCOPe 2.08, called d4u2ub1