Lineage for d4u2ub1 (4u2u B:23-182)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021541Family f.1.4.0: automated matches [195065] (1 protein)
    not a true family
  6. 3021542Protein automated matches [195066] (5 species)
    not a true protein
  7. 3021546Species Human (Homo sapiens) [TaxId:9606] [225196] (14 PDB entries)
  8. 3021566Domain d4u2ub1: 4u2u B:23-182 [259549]
    Other proteins in same PDB: d4u2ua2, d4u2ub2
    automated match to d2imta_

Details for d4u2ub1

PDB Entry: 4u2u (more details), 2.9 Å

PDB Description: bak domain swapped dimer induced by bidbh3 with chaps
PDB Compounds: (B:) bcl-2 homologous antagonist/killer

SCOPe Domain Sequences for d4u2ub1:

Sequence, based on SEQRES records: (download)

>d4u2ub1 f.1.4.0 (B:23-182) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvgrqlaiig
ddinrrydsefqtmlqhlqptaenayeyftkiatslfesginwgrvvallgfgyrlalhv
yqhgltgflgqvtrfvvdfmlhhsiarwiaqrggwvaaln

Sequence, based on observed residues (ATOM records): (download)

>d4u2ub1 f.1.4.0 (B:23-182) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seeqvaqdteevfrsyvfyrhqqeqestmgqvgrqlaiigddinrrydsefqtmlqhlqp
taenayeyftkiatslfesginwgrvvallgfgyrlalhvyqhgltgflgqvtrfvvdfm
lhhsiarwiaqrggwvaaln

SCOPe Domain Coordinates for d4u2ub1:

Click to download the PDB-style file with coordinates for d4u2ub1.
(The format of our PDB-style files is described here.)

Timeline for d4u2ub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4u2ub2