Class b: All beta proteins [48724] (119 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (40 proteins) |
Protein Trypsin(ogen) [50515] (8 species) |
Species Cow (Bos taurus) [TaxId:9913] [50516] (148 PDB entries) |
Domain d1mtu__: 1mtu - [25940] complexed with bx3, ca |
PDB Entry: 1mtu (more details), 1.9 Å
SCOP Domain Sequences for d1mtu__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mtu__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)} ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
Timeline for d1mtu__: