Lineage for d4untc_ (4unt C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355178Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)
  8. 2355658Domain d4untc_: 4unt C: [259304]
    automated match to d2rhea_
    complexed with so4

Details for d4untc_

PDB Entry: 4unt (more details), 2.7 Å

PDB Description: Induced monomer of the Mcg variable domain
PDB Compounds: (C:) ig lambda chain v-II region mgc

SCOPe Domain Sequences for d4untc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4untc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsgvp
drfsgsksgntasltvsglqaedeadyycssyegsdnavegtgtkvtvl

SCOPe Domain Coordinates for d4untc_:

Click to download the PDB-style file with coordinates for d4untc_.
(The format of our PDB-style files is described here.)

Timeline for d4untc_: