| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
| Domain d4untc_: 4unt C: [259304] automated match to d2rhea_ complexed with so4 |
PDB Entry: 4unt (more details), 2.7 Å
SCOPe Domain Sequences for d4untc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4untc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsgvp
drfsgsksgntasltvsglqaedeadyycssyegsdnavegtgtkvtvl
Timeline for d4untc_: