SCOPe 2.05: Domain d4ceub_: 4ceu B:

Lineage for d4ceub_ (4ceu B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (1 family)

5. Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)

6. Protein Urease, beta-subunit [51280] (4 species)

7. Species Bacillus pasteurii [TaxId:1474] [51282] (8 PDB entries)

8. Domain d4ceub_: 4ceu B: [259180]
   Other proteins in same PDB: d4ceua_, d4ceuc1, d4ceuc2
   automated match to d4ubpb_
   complexed with edo, ni, oh, so4

Details for d4ceub_

PDB Entry: 4ceu, 1.58 Å

PDB Description: 1.58 a resolution native sporosarcina pasteurii urease

PDB Compounds: (B:) urease subunit beta

SCOPe Domain Sequences for d4ceub_:

Sequence; same for both SEQRES and ATOM records:

>d4ceub_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii [TaxId: 1474]}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

Timeline for d4ceub_:

• d4ceub_ first appeared in SCOPe 2.04
  
• d4ceub_ appears in SCOPe 2.06
  
• d4ceub_ appears in the current release, SCOPe 2.08