Lineage for d4ceub_ (4ceu B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2083143Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2083241Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) (S)
  5. 2083242Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
  6. 2083243Protein Urease, beta-subunit [51280] (4 species)
  7. 2083244Species Bacillus pasteurii [TaxId:1474] [51282] (11 PDB entries)
  8. 2083247Domain d4ceub_: 4ceu B: [259180]
    Other proteins in same PDB: d4ceua_, d4ceuc1, d4ceuc2
    automated match to d4ubpb_
    complexed with edo, ni, oh, so4

Details for d4ceub_

PDB Entry: 4ceu (more details), 1.58 Å

PDB Description: 1.58 a resolution native sporosarcina pasteurii urease
PDB Compounds: (B:) urease subunit beta

SCOPe Domain Sequences for d4ceub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ceub_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii [TaxId: 1474]}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

SCOPe Domain Coordinates for d4ceub_:

Click to download the PDB-style file with coordinates for d4ceub_.
(The format of our PDB-style files is described here.)

Timeline for d4ceub_: